PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03192.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 150aa    MW: 16658.3 Da    PI: 7.5009
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03192.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.85.7e-095371547
                             HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
  Rsa1.0_03192.1_g00003.1  5 GLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 37
                             789*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.073142IPR017930Myb domain
SuperFamilySSF466895.07E-10141IPR009057Homeodomain-like
CDDcd001674.10E-6138No hitNo description
TIGRFAMsTIGR015571.1E-10241IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-6337IPR009057Homeodomain-like
PfamPF002492.2E-6537IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
QFLIGLKKYG KGDWRNIARN FVTTRTPTQV ASHAQKYFIR QVNGGKDKRR SSIHDITTVN  60
VPDSPDTGAA DTSTANAPCS PPSLGGSQRE ASDQWEGQTI YDETSAAFYN QNAFQETLLG  120
MSSTPYMAKL QEQSFLNASQ FESYNAYLQM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010517093.15e-96PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-37DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4MIQ71e-94V4MIQ7_EUTSA; Uncharacterized protein
STRINGBra005139.1-P7e-92(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-94MYB family protein